PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00001826001
Common NameGSBRNA2T00001826001, LOC106369361, LOC106431541
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 261aa    MW: 28971.3 Da    PI: 7.9247
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00001826001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.65.1e-323184255
              G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                         prlrWtpeLH++F++av+ LGG+++AtPk il++m+v gLt++hvkSHLQ+YR 
  GSBRNA2T00001826001 31 PRLRWTPELHRCFLNAVDMLGGQHRATPKLILKMMDVRGLTISHVKSHLQMYRG 84
                         8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.0E-292784IPR009057Homeodomain-like
PROSITE profilePS5129414.2292787IPR017930Myb domain
SuperFamilySSF466891.79E-153183IPR009057Homeodomain-like
TIGRFAMsTIGR015572.4E-243184IPR006447Myb domain, plants
PfamPF002492.0E-93283IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MGTCGGRNGN DVGFNGHGGG RVRPYVRSPV PRLRWTPELH RCFLNAVDML GGQHRATPKL  60
ILKMMDVRGL TISHVKSHLQ MYRGSKLTLG KSEESSLSSI RRRQDTEEDY LHDNLSLPSR  120
NDCLLGFHSF PLSSHSSLRG GRRENQTSQS GGGDDDDDFL HIINMEKTKE TTAFPSHQCH  180
KKTEKEKNKW ENSGKEQEEE DLSLSLSLNH HQWRSNGSSV SETSEAVSTC SAPFVFKDCF  240
ASSSPKIDLN LTLSVSLLSS *
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00001826001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFJ3864031e-60FJ386403.1 Thellungiella halophila putative inositol phosphatase gene, partial cds; cyclin-like protein, putative microtubule-associated protein, putative C2H2 zinc finger protein, brassinosteroid receptor-like protein, putative transmembrane transporter, salt overly sensitive 1-like protein, valyl-tRNA synthetase-like protein, putative glutamate decarboxylase, putative peptide transporter, putative F-box protein, putative nitrate transporter, putative NADH dehydrogenase, putative Myb DNA binding proteins, putative C2H2 zinc finger proteins, putative F-box protein, SWI/SNF helicase-like protein, defensin-like proteins, and putative PPR repeat protein genes, complete cds; and unknown genes.
GenBankHM2229241e-60HM222924.1 Thellungiella parvula phosphatase, cyclin J18, clathrin assembly protein-related protein, BPC1, SGR5/ATIDD15, leucine-rich receptor kinase, endomemebrane protein 70, salt overly sensitive 1, glutamate decarboxylae 4, oligopeptide transport protein, peptide transporter, and NADH-ubiquinone oxidoreductase B18 genes, complete cds; and unknown genes.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013664978.10.0PREDICTED: putative Myb family transcription factor At1g14600
RefseqXP_013727789.10.0PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
RefseqXP_013727790.10.0PREDICTED: putative Myb family transcription factor At1g14600 isoform X2
SwissprotQ700D92e-78MYBF_ARATH; Putative Myb family transcription factor At1g14600
TrEMBLA0A078FXY60.0A0A078FXY6_BRANA; BnaA06g34360D protein
STRINGBra024836.1-P1e-175(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM46941852
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.14e-43G2-like family protein
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]